PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC054619.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 387aa    MW: 42790.4 Da    PI: 8.284
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC054619.50genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-31281334255
       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                   pr+rWt+ LH+rFv+av  LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EcC054619.50 281 PRMRWTSSLHARFVHAVGLLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 334
                   9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-15278335IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-28279335IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-23281334IPR006447Myb domain, plants
PfamPF002495.5E-6282333IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006071Biological Processglycerol metabolic process
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007186Biological ProcessG-protein coupled receptor signaling pathway
GO:0009642Biological Processresponse to light intensity
GO:0009651Biological Processresponse to salt stress
GO:0009697Biological Processsalicylic acid biosynthetic process
GO:0010188Biological Processresponse to microbial phytotoxin
GO:0010310Biological Processregulation of hydrogen peroxide metabolic process
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003924Molecular FunctionGTPase activity
GO:0003993Molecular Functionacid phosphatase activity
GO:0004371Molecular Functionglycerone kinase activity
GO:0004871Molecular Functionsignal transducer activity
GO:0005509Molecular Functioncalcium ion binding
GO:0005524Molecular FunctionATP binding
GO:0005544Molecular Functioncalcium-dependent phospholipid binding
GO:0008270Molecular Functionzinc ion binding
GO:0019001Molecular Functionguanyl nucleotide binding
GO:0031683Molecular FunctionG-protein beta/gamma-subunit complex binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MEEESSFPDL SLHISPPNSA PSSICGGGNN EGDSNSSFDI WRRGAEDDDD YHYALKSHSD  60
SSVLKADAAA DTRLSLSNLP AAAVAASNPL EAESPWRRSM MDTHNGDHQV EDYFKRRHAI  120
GNGSLGHISS GMSLLGVSDR LRPIKGIPVY NTGACNNSFQ FPLQADRDFP RDVMTTRDTN  180
PKLSYNFPRP SNIMMSMNNS SSSPSNYFEP MYVLNSGGGG GSRFNGITMD NLNHNFKSRQ  240
MMMQYLHQHH QYGSSGESNG LVSRFRFVPK LQSNKRNMRA PRMRWTSSLH ARFVHAVGLL  300
GGHERATPKS VLELMDVKDL TLAHVKSHLQ MYRTVKNTDK AAASSDGSAD EDFLPPLKTF  360
QQNGNQRADG SNQSVSTGHN MWTNSSR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010069448.10.0PREDICTED: probable transcription factor KAN4 isoform X3
TrEMBLA0A059AVB00.0A0A059AVB0_EUCGR; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s03900.11e-88(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-37G2-like family protein